A10404
CORIN Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A10404
- Additional Names:
- ATC2|CORIN|CRN|Lrp4|PEE5|TMPRSS10
- Application:
- ELISA, WB
- Molecular Weight:
- 116kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MKQSPALAPEERCRRAGSPKPVLRADDNNMGNGCSQKLATANLLRFLLLVLIPCICALVLLLVILLSYVGTLQKVYFKSNGSEPLVTDGEIQGSDVILTNTIYNQSTVVS
- Uniprot:
- Q9Y5Q5
- Synonyms:
- ATC2;atrial natriuretic peptide-converting enzyme;Corin;CRN;heart-specific serine proteinase ATC2;Lrp4;PEE5;pro-ANP-convertase;pro-ANP-converting enzyme;TMPRSS10;transmembrane protease serine 10
- Extra Details:
- This gene encodes a member of the type II transmembrane serine protease class of the trypsin superfamily. Members of this family are composed of multiple structurally distinct domains. The encoded protein converts pro-atrial natriuretic peptide to biologically active atrial natriuretic peptide, a cardiac hormone that regulates blood volume and pressure. This protein may also function as a pro-brain-type natriuretic peptide convertase. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice