YME1L1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A10402
Additional Names:: FTSH|MEG4|OPA11|PAMP|YME1L|YME1L1
Application:: ELISA, WB
Molecular Weight:: 65kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MFSLSSTVQPQVTVPLSHLINAFHTPKNTSVSLSGVSVSQNQHRDVVPEHEAPSSEPSLNLRDLGLSELKIGQIDQLVENLLPGFCKGKNISSHWHTSHVSAQSFFENKYGNLDIFSTLRSSCLYRHHSRALQSICSDLQYWPVFIQSRGFKTLKSRTRRLQSTSERLAETQNIAPSFVKGFLLRDRGSDVESLDKLMKTKNIPEAHQDAFKTGFAEGFLKAQALTQKTNDSLRRTRLIL
Uniprot:: Q96TA2
Synonyms:: ATP-dependent metalloprotease FtsH1;ATP-dependent metalloprotease FtsH1 homolog;ATP-dependent zinc metalloprotease YME1L1;FTSH;meg-4;MEG4;OPA11;PAMP;presenilin-associated metalloprotease;YME1-like protein 1;YME1L
Extra Details:: The protein encoded by this gene is the human ortholog of yeast mitochondrial AAA metalloprotease, Yme1p. It is localized in the mitochondria and can functionally complement a yme1 disruptant yeast strain. It is proposed that this gene plays a role in mitochondrial protein metabolism and could be involved in mitochondrial pathologies. Three transcript variants encoding different isoforms have been found for this gene.