A10382
ERAL1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A10382
- Additional Names:
- CEGA|ERA|ERA-W|ERAL1|ERAL1A|ERAL1B|H-ERA|HERA-A|HERA-B|PRLTS6
- Application:
- ELISA, WB
- Molecular Weight:
- 48kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- DLVVVLVDVSDKWTRNQLSPQLLRCLTKYSQIPSVLVMNKVDCLKQKSVLLELTAALTEGVVNGKKLKMRQAFHSHPGTHCPSPAVKDPNTQSVGNPQRIGWPHFKEIFMLSALSQEDVKTLKQYLLTQAQPGPWEYHSAVLTSQTPEEICANIIREKLLEHLPQEVPYNVQQKTAVWEEGPGGELVIQQKLLVPKESYVKLLIGPKGHVISQIAQEAGHDLMDIFLCDVDIRLSVKLLK
- Uniprot:
- O75616
- Synonyms:
- CEGA;conserved ERA-like GTPase;ERA;era (E. coli G-protein homolog)-like 1;Era G-protein-like 1;ERA-like protein 1;ERA-W;ERAL1A;ERAL1B;GTP-binding protein era homolog;GTPase Era, mitochondrial;GTPase, human homolog of E. coli essential cell cycle protein Era;H-ERA;HERA-A;HERA-B;PRLTS6
- Extra Details:
- The protein encoded by this gene is a GTPase that localizes to the mitochondrion. The encoded protein binds to the 3' terminal stem loop of 12S mitochondrial rRNA and is required for proper assembly of the 28S small mitochondrial ribosomal subunit. Deletion of this gene has been shown to cause mitochondrial dysfunction, growth retardation, and apoptosis. Several transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice