A10380
CHMP2A Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A10380
- Additional Names:
- BC-2|BC2|CHMP2|CHMP2A|VPS2|VPS2A
- Application:
- ELISA, WB
- Molecular Weight:
- 37kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSNLPSTGGSLSVAAGGKKAEAAASALADADADLEERLKNLRRD
- Uniprot:
- O43633
- Synonyms:
- BC-2;BC2;charged multivesicular body protein 2a;CHMP2;chromatin modifying protein 2A;Chromatin-modifying protein 2a;putative breast adenocarcinoma marker (32kD);putative breast adenocarcinoma marker BC-2;vacuolar protein sorting-associated protein 2-1;VPS2;VPS2 homolog A;vps2-1;VPS2A
- Extra Details:
- CHMP2A belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]).
- Shipping Conditions:
- Blue Ice