Cytokeratin 2e (KRT2) Rabbit polyclonal antibody

Size

£152.00

SKU:: A10375
Additional Names:: CK-2e|Cytokeratin 2e (KRT2)|K2e|KRT2A|KRT2E|KRTE
Application:: ELISA, WB
Molecular Weight:: 65kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MSCQISCKSRGRGGGGGGFRGFSSGSAVVSGGSRRSTSSFSCLSRHGGGGGGFGGGGFGSRSLVGLGGTKSISISVAGGGGGFGAAGGFGGRGGGFGGGSSFGGGSGFSGGGFGGGGFGGGRFGGFGGPGGVGGLGGPGGFGPGGYPGGIHEVSVNQSLLQPLNVKVDPEIQNVKAQEREQIKTLNNKFASFIDKVRFLEQQNQVLQTKWELLQQMNVGT
Uniprot:: P35908
Synonyms:: CK-2e;cytokeratin-2e;epithelial keratin-2e;K2e;keratin 2, type II;keratin-2 epidermis;keratin-2e;keratin, type II cytoskeletal 2 epidermal;KRT2A;KRT2E;KRTE;type-II keratin Kb2
Extra Details:: The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is expressed largely in the upper spinous layer of epidermal keratinocytes and mutations in this gene have been associated with bullous congenital ichthyosiform erythroderma. The type II cytokeratins are clustered in a region of chromosome 12q12-q13.