A10331
L3MBTL2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A10331
- Additional Names:
- H-l(3)mbt-l|L3MBT|L3MBTL2
- Application:
- ELISA, WB
- Molecular Weight:
- 95kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- PATFCQKNDIELTPPKGYEAQTFNWENYLEKTKSKAAPSRLFNMDCPNHGFKVGMKLEAVDLMEPRLICVATVKRVVHRLLSIHFDGWDSEYDQWVDCESPDIYPVGWCELTGYQLQPPVAAEPATPLKAKEATKKKKKQFGKKRKRIPPTKTRPLRQGSKKPLLEDDPQGARKISSEPVPGEIIAVRVKEEHLDVASPDKASSPELPVSVENIKQETDD
- Uniprot:
- Q969R5
- Synonyms:
- H-l(3)mbt-l;H-l(3)mbt-like protein 2;l(3)mbt-like 2;L(3)mbt-like protein 2;L3MBT;L3MBTL2, polycomb repressive complex 1 subunit;lethal(3)malignant brain tumor-like protein 2
- Extra Details:
- Enables methylated histone binding activity. Predicted to be involved in negative regulation of transcription, DNA-templated. Predicted to act upstream of or within several processes, including ectoderm development; regulation of histone modification; and stem cell proliferation. Located in nucleus.
- Shipping Conditions:
- Blue Ice