MS4A8B Rabbit polyclonal antibody

Size

£152.00

SKU:: A10330
Additional Names:: 4SPAN4|CD20L5|MS4A4|MS4A8B
Application:: ELISA, WB
Molecular Weight:: 26kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SISFYGGFPFWGGLWFIISGSLSVAAENQPYSYCLLSGSLGLNIVSAICSAVGVILFITDLSIPHPYAYPDYYPYAWGVNPGMAISGVLLVFCLLEFGIAC
Uniprot:: Q9BY19
Synonyms:: 4SPAN4;CD20L5;four-span transmembrane protein 4;membrane-spanning 4-domains subfamily A member 8;Membrane-spanning 4-domains subfamily A member 8B;membrane-spanning 4-domains, subfamily A, member 8B;MS4A4;MS4A8B
Extra Details:: This gene encodes a member of the membrane-spanning 4A gene family. Members of this protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. The gene encoding this protein is localized to 11q12.3, among a cluster of family members.