LRRC4 Rabbit polyclonal antibody

Size

£152.00

SKU:: A10321
Additional Names:: LRRC4|NAG14|NGL-2
Application:: ELISA, WB
Molecular Weight:: 73kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LIVFYKLRKRHQQRSTVTAARTVEIIQVDEDIPAATSAAATAAPSGVSGEGAVVLPTIHDHINYNTYKPAHGAHWTENSLGNSLHPTVTTISEPYIIQTHTKDKVQETQI
Uniprot:: Q9HBW1
Synonyms:: brain tumor associated protein LRRC4;brain tumor-associated protein BAG;leucine-rich repeat-containing protein 4;NAG14;nasopharyngeal carcinoma-associated gene 14 protein;netrin-G2 ligand;NGL-2
Extra Details:: Predicted to be involved in modulation of chemical synaptic transmission and synapse organization. Predicted to act upstream of or within synapse organization. Predicted to be located in neuron spine and postsynaptic membrane. Predicted to be active in Schaffer collateral - CA1 synapse; glutamatergic synapse; and plasma membrane. Predicted to be integral component of postsynaptic density membrane.