A10320
SLC28A3 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A10320
- Additional Names:
- CNT3|SLC28A3
- Application:
- ELISA, WB
- Molecular Weight:
- 77kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LSSTPVDINCHHVLENAFNSTFPGNTTKVIACCQSLLSSTVAKGPGEVIPGGNHSLYSLKGCCTLLNPSTFNCNGISNTF
- Uniprot:
- Q9HAS3
- Synonyms:
- CNT3;concentrative Na(+)-nucleoside cotransporter 3;concentrative Na+-nucleoside cotransporter;solute carrier family 28 (concentrative nucleoside transporter), member 3;solute carrier family 28 (sodium-coupled nucleoside transporter), member 3;solute carrier family 28 member 3
- Extra Details:
- Nucleoside transporters, such as SLC28A3, regulate multiple cellular processes, including neurotransmission, vascular tone, adenosine concentration in the vicinity of cell surface receptors, and transport and metabolism of nucleoside drugs. SLC28A3 shows broad specificity for pyrimidine and purine nucleosides (Ritzel et al., 2001 [PubMed 11032837]).
- Shipping Conditions:
- Blue Ice