CISD1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A10317
Additional Names:: C10orf70|CISD1|MDS029|mitoNEET|ZCD1
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 16 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET
Uniprot:: Q9NZ45
Synonyms:: C10orf70;CDGSH iron-sulfur domain-containing protein 1;MDS029;mitoNEET;ZCD1;zinc finger CDGSH-type domain 1
Extra Details:: This gene encodes a protein with a CDGSH iron-sulfur domain and has been shown to bind a redox-active [2Fe-2S] cluster. The encoded protein has been localized to the outer membrane of mitochondria and is thought to play a role in regulation of oxidation. Genes encoding similar proteins are located on chromosomes 4 and 17, and a pseudogene of this gene is located on chromosome 2.