SCN3B Rabbit polyclonal antibody

Size

£152.00

SKU:: A10316
Additional Names:: ATFB16|BRGDA7|HSA243396|SCN3B|SCNB3
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 30kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: FPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVVEWFYRPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLNDSGLYTCNVSREFEFEAHRPFVKTTRLIPLRVTEEAGEDFTSVVSEI
Uniprot:: Q9NY72
Synonyms:: ATFB16;BRGDA7;HSA243396;SCNB3;sodium channel subunit beta-3;sodium channel, voltage-gated, type III, beta subunit;voltage-gated sodium channel beta-3 subunit
Extra Details:: Voltage-gated sodium channels are transmembrane glycoprotein complexes composed of a large alpha subunit and one or more regulatory beta subunits. They are responsible for the generation and propagation of action potentials in neurons and muscle. This gene encodes one member of the sodium channel beta subunit gene family, and influences the inactivation kinetics of the sodium channel. Two alternatively spliced variants, encoding the same protein, have been identified.