A10315
CACNA2D3 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A10315
- Additional Names:
- CACNA2D3|HSA272268
- Application:
- ELISA, WB
- Molecular Weight:
- 123kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LYDYQAMCRANKESSDGAHGLLDPYNAFLSAVKWIMTELVLFLVEFNLCSWWHSDMTAKAQKLKQTLEPCDTEYPAFVSERTIKETTGNIACEDCSKSFVIQQIPSSNLFMVVVDSSCLCESVAPITMAPIEIRYNESLKC
- Uniprot:
- Q8IZS8
- Synonyms:
- calcium channel alpha2-delta3 subunit;calcium channel, voltage-dependent, alpha 2/delta 3 subunit;calcium channel, voltage-dependent, alpha 2/delta subunit 3;HSA272268;voltage-dependent calcium channel subunit alpha-2/delta-3;voltage-gated calcium channel subunit alpha-2/delta-3
- Extra Details:
- This gene encodes a member of the alpha-2/delta subunit family, a protein in the voltage-dependent calcium channel complex. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. Various versions of each of these subunits exist, either expressed from similar genes or the result of alternative splicing. Research on a highly similar protein in rabbit suggests the protein described in this record is cleaved into alpha-2 and delta subunits. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized.
- Shipping Conditions:
- Blue Ice

