A10286
GADD45G Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A10286
- Additional Names:
- CR6|DDIT2|GADD45G|GADD45gamma|GRP17
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 17kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- IDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
- Uniprot:
- O95257
- Synonyms:
- CR6;cytokine-responsive protein CR6;DDIT-2;DDIT2;DNA damage-inducible transcript 2 protein;gadd-related protein, 17 kD;GADD45-gamma;GADD45gamma;growth arrest and DNA damage-inducible protein GADD45 gamma;GRP17
- Extra Details:
- This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The GADD45G is highly expressed in placenta.
- Shipping Conditions:
- Blue Ice