DHRS4 Rabbit polyclonal antibody

Size

£152.00

SKU:: A10285
Additional Names:: CR|DHRS4|NRDR|PHCR|PSCD|SCAD-SRL|SDR-SRL|SDR25C1|SDR25C2
Application:: ELISA, WB
Molecular Weight:: 30kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MHKAGLLGLCARAWNSVRMASSGMTRRDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAVNPFFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDKEKEESMKETLRIRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGGTPSRL
Uniprot:: Q9BTZ2
Synonyms:: CR;dehydrogenase/reductase (SDR family) member 4 like 2A;dehydrogenase/reductase SDR family member 4;NADPH-dependent carbonyl reductase/NADP-retinol dehydrogenase;NADPH-dependent retinol dehydrogenase/reductase;NRDR;peroxisomal short-chain alcohol dehydrogenase;PHCR;PSCD;SCAD-SRL;SDR-SRL;SDR25C1;SDR25C2;short chain dehydrogenase/reductase family 25C member 2;short chain dehydrogenase/reductase family 25C, member 1;short-chain dehydrogenase/reductase family member 4
Extra Details:: Enables identical protein binding activity; oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor; and oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor. Involved in several processes, including cellular ketone metabolic process; positive regulation of reactive oxygen species metabolic process; and steroid metabolic process. Located in nucleus and peroxisomal membrane.

Shipping Conditions:: Blue Ice