A10281
POMT1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A10281
- Additional Names:
- LGMD2K|LGMDR11|MDDGA1|MDDGB1|MDDGC1|POMT1|RT
- Application:
- ELISA, WB
- Molecular Weight:
- 63kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- VFGKPVPCWLHSHQDTYPMIYENGRGSSHQQQVTCYPFKDVNNWWIVKDPRRHQLVVSSPPRPVRHGDMVQLVHGMTTRSLNTHDVAAPLSPHSQEVSCYIDYNISMPAQNLWRLEIVNRGSDTDVWKTILSEVRFVHVNTSAVLKLSGAHLPDWGYRQLEIVGEKLSRGYHGSTVWNVEEHRYGASQEQRERERELHSPAQVDVSRNLSFMARFSELQWRMLALRSDDSEHKYSSSPLEW
- Uniprot:
- Q9Y6A1
- Synonyms:
- dolichyl-phosphate-mannose--protein mannosyltransferase 1;LGMD2K;LGMDR11;MDDGA1;MDDGB1;MDDGC1;protein O-mannosyl-transferase 1;RT;testis tissue sperm-binding protein Li 57p;truncated O-mannosyl-transferase 1 variant SV3DEL
- Extra Details:
- The protein encoded by this gene is an O-mannosyltransferase that requires interaction with the product of the POMT2 gene for enzymatic function. The encoded protein is found in the membrane of the endoplasmic reticulum. Defects in this gene are a cause of Walker-Warburg syndrome (WWS) and limb-girdle muscular dystrophy type 2K (LGMD2K). Several transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice

