A10277
KCNMB2 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A10277
- Additional Names:
- KCNMB2
- Application:
- ELISA, WB
- Molecular Weight:
- 30kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- TLLRSYMQSVWTEESQCTLLNASITETFNCSFSCGPDCWKLSQYPCLQVYVNLTSSGEKLLLYHTEETIKINQKCSYIPKCGKNFEESMSLVNVVMENFRKYQHFSCYSDPEGNQKSVILTKLYSSN
- Uniprot:
- Q9Y691
- Synonyms:
- big potassium channel beta subunit 2;BK channel beta subunit 2;BK channel subunit beta-2;calcium-activated potassium channel subunit beta-2;Calcium-activated potassium channel, subfamily M subunit beta-2;charybdotoxin receptor subunit beta-2;hbeta2;Hbeta3;hCG1646471;k(VCA)beta-2;large conductance calcium-activated potassium channel beta 2 subunit;large-conductance Ca2+-activated K+ channel beta2 subunit;Maxi K channel subunit beta-2;MaxiK channel beta 2 subunit;MaxiK channel beta-subunit 2;potassium channel subfamily M regulatory beta subunit 2;potassium large conductance calcium-activated channel, subfamily M, beta member 2;slo-beta-2
- Extra Details:
- MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the modulatory beta subunit. The protein encoded by this gene is an auxiliary beta subunit which decreases the activation time of MaxiK alpha subunit currents. Alternative splicing results in multiple transcript variants of this gene. Additional variants are discussed in the literature, but their full length nature has not been described.
- Shipping Conditions:
- Blue Ice

