ADAMTS2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A10272
Additional Names:: ADAM-TS2|ADAMTS-2|ADAMTS-3|ADAMTS2|EDSDERMS|NPI|PC I-NP|PCI-NP|PCINP|PCPNI|PNPI
Application:: ELISA, WB
Molecular Weight:: 120kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: PRNISDPSKKSYVVQWLSRPDPDSPIRKISSKGHCQGDKSIFCRMEVLSRYCSIPGYNKLCCKSCNLYNNLTNVEGRIEPPPGKHNDIDVFMPTLPVPTVAMEVRPSPSTPLEVPLNASSTNATEDHPETNAVDEPYKIHGLEDEVQPPNLIPRRPSPYEKTRNQRIQELIDEMRKKEMLGKF
Uniprot:: O95450
Synonyms:: A disintegrin and metalloproteinase with thrombospondin motifs 2;a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 2;ADAM-TS2;ADAMTS-2;ADAMTS-3;EDSDERMS;NPI;PC I-NP;PCI-NP;PCINP;PCPNI;PNPI;procollagen I N-proteinase;procollagen I/II amino propeptide-processing enzyme;procollagen N-endopeptidase
Extra Details:: This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The encoded preproprotein is proteolytically processed to generate the mature procollagen N-proteinase. This proteinase excises the N-propeptide of the fibrillar procollagens types I-III and type V. Mutations in this gene cause Ehlers-Danlos syndrome type VIIC, a recessively inherited connective-tissue disorder. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed.

Shipping Conditions:: Blue Ice