A10255
XPNPEP2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A10255
- Additional Names:
- AEACEI|APP2|XPNPEP2
- Application:
- ELISA, WB
- Molecular Weight:
- 76kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- HTKPVDLGGQDVRNCSTNPPYLPVTVVNTTMSLTALRQQMQTQNLSAYIIPGTDAHMNEYIGQHDERRAWITGFTGSAGTAVVTMKKAAVWTDSRYWTQAERQMDCNWELHKEVGTTPIVTWLLTEIPAGGRVGFDPFLLSIDTWESYDLALQGSNRQLVSITTNLVDLVWGSERPPVPNQPIYALQEAFTGSTWQEKVSGVRSQMQKHQKVPTAVLLS
- Uniprot:
- O43895
- Synonyms:
- AEACEI;aminoacylproline aminopeptidase;APP2;mAmP;membrane-bound aminopeptidase P;membrane-bound AmP;membrane-bound APP;X-Pro aminopeptidase 2;X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound;xaa-Pro aminopeptidase 2
- Extra Details:
- Aminopeptidase P is a hydrolase specific for N-terminal imido bonds, which are common to several collagen degradation products, neuropeptides, vasoactive peptides, and cytokines. Structurally, the enzyme is a member of the 'pita bread fold' family and occurs in mammalian tissues in both soluble and GPI-anchored membrane-bound forms. A membrane-bound and soluble form of this enzyme have been identified as products of two separate genes.
- Shipping Conditions:
- Blue Ice