NR2F2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A10251
Additional Names:: ARP-1|ARP1|CHTD4|COUPTF2|COUPTFB|COUPTFII|NF-E3|NR2F2|SRXX5|SVP40|TFCOUP2
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 47kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQGGPGGPGSDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCK
Uniprot:: P24468
Synonyms:: ADP-ribosylation factor related protein 1;apolipoprotein A-I regulatory protein 1;apolipoprotein AI regulatory protein 1;ARP-1;ARP1;chicken ovalbumin upstream promoter transcription factor 2;chicken ovalbumin upstream promoter-transcription factor I;CHTD4;COUP transcription factor 2;COUP transcription factor II;COUPTF2;COUPTFB;COUPTFII;NF-E3;Nuclear receptor subfamily 2 group F member 2;SRXX5;SVP40;TFCOUP2
Extra Details:: This gene encodes a member of the steroid thyroid hormone superfamily of nuclear receptors. The encoded protein is a ligand inducible transcription factor that is involved in the regulation of many different genes. Alternate splicing results in multiple transcript variants.