A10244
SLC1A7 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A10244
- Additional Names:
- AAAT|EAAT5|SLC1A7
- Application:
- ELISA, WB
- Molecular Weight:
- 72kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- DFARDTGTEKLLPCETKPVSLQEIVAAQQNGCVKSVAEASELTLGPTCPHHVPVQVEQDEELPAASLNHCTIQISELETNV
- Uniprot:
- O00341
- Synonyms:
- AAAT;EAAT5;excitatory amino acid transporter 5;excitatory amino acid transporter 5 (retinal glutamate transporter);retinal glutamate transporter;solute carrier family 1 (glutamate transporter), member 7;Solute carrier family 1 member 7
- Extra Details:
- Predicted to enable anion transmembrane transporter activity. Involved in neurotransmitter reuptake. Predicted to be located in plasma membrane. Predicted to be active in glutamatergic synapse. Predicted to be integral component of postsynaptic membrane and integral component of presynaptic membrane.
- Shipping Conditions:
- Blue Ice

