A10238
Septin 4 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A10238
- Additional Names:
- ARTS|BRADEION|C17orf47|CE5B3|H5|hCDCREL-2|hucep-7|MART|PNUTL2|SEP4|SEPT4|Septin 4
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 45kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MIKRFLEDTTDDGELSKFVKDFSGNASCHPPEAKTWASRPQVPEPRPQAPDLYDDDLEFRPPSRPQSSDNQQYFCAPAPLSPSARPRSPWGKLDPYDSSE
- Uniprot:
- O43236
- Synonyms:
- apoptosis-related protein in the TGF-beta signaling pathway;ARTS;BRADEION;bradeion beta;brain protein H5;C17orf47;CE5B3;CE5B3 beta;cell division control-related protein 2;cerebral protein 7;H5;hCDCREL-2;hucep-7;MART;peanut-like protein 2;PNUTL2;SEP4;SEPT4;septin-4;septin-M;uncharacterized protein C17orf47
- Extra Details:
- This gene is a member of the septin family of nucleotide binding proteins, originally described in yeast as cell division cycle regulatory proteins. Septins are highly conserved in yeast, Drosophila, and mouse, and appear to regulate cytoskeletal organization. Disruption of septin function disturbs cytokinesis and results in large multinucleate or polyploid cells. This gene is highly expressed in brain and heart. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. One of the isoforms (known as ARTS) is distinct; it is localized to the mitochondria, and has a role in apoptosis and cancer.
- Shipping Conditions:
- Blue Ice







