A10220
H3F3B Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A10220
- Additional Names:
- BRYLIB2|H3-3A|H3.3B|H3F3B
- Application:
- ELISA, WB
- Molecular Weight:
- 15kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
- Uniprot:
- P84243
- Synonyms:
- H3 histone family member 3A;H3 histone family member 3B;H3 histone, family 3A;H3 histone, family 3B (H3.3B);H3-3A;H3-3B;H3.3A;H3.3B;H3F3;H3F3A;H3F3B;histone H3.3
- Extra Details:
- Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene contains introns and its mRNA is polyadenylated, unlike most histone genes. The protein encoded by this gene is a replication-independent histone that is a member of the histone H3 family. Pseudogenes of this gene have been identified on the X chromosome, and on chromosomes 5, 13 and 17.
- Shipping Conditions:
- Blue Ice

