A10209
DIAPH2 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A10209
- Additional Names:
- DIA|DIA2|DIAPH2|DRF2|POF|POF2|POF2A
- Application:
- ELISA, WB
- Molecular Weight:
- 125kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MEQPGAAASGAGGGSEEPGGGRSNKRSAGNRAANEEETKNKPKLNIQIKTLADDVRDRITSFRKSTVKKEKPLIQHPIDSQVAMSEFPAAQPLYDERSLNLSEKEVLDLFEKMMEDMNLN
- Uniprot:
- O60879
- Synonyms:
- DIA;DIA2;diaphanous homolog 2;Diaphanous-related formin-2;diaphorase-2;DRF2;POF;POF2;POF2A;protein diaphanous homolog 2
- Extra Details:
- The product of this gene belongs to the diaphanous subfamily of the formin homology family of proteins. This gene may play a role in the development and normal function of the ovaries. Defects in this gene have been linked to premature ovarian failure 2. Alternatively spliced transcript variants encoding different isoforms have been identified.
- Shipping Conditions:
- Blue Ice

