DIAPH2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A10209
Additional Names:: DIA|DIA2|DIAPH2|DRF2|POF|POF2|POF2A
Application:: ELISA, WB
Molecular Weight:: 125kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MEQPGAAASGAGGGSEEPGGGRSNKRSAGNRAANEEETKNKPKLNIQIKTLADDVRDRITSFRKSTVKKEKPLIQHPIDSQVAMSEFPAAQPLYDERSLNLSEKEVLDLFEKMMEDMNLN
Uniprot:: O60879
Synonyms:: DIA;DIA2;diaphanous homolog 2;Diaphanous-related formin-2;diaphorase-2;DRF2;POF;POF2;POF2A;protein diaphanous homolog 2
Extra Details:: The product of this gene belongs to the diaphanous subfamily of the formin homology family of proteins. This gene may play a role in the development and normal function of the ovaries. Defects in this gene have been linked to premature ovarian failure 2. Alternatively spliced transcript variants encoding different isoforms have been identified.