ZSCAN4C Rabbit polyclonal antibody

Size

£152.00

SKU:: A10205
Additional Names:: Gm397|XM_142517|ZSCAN4C|Zscan4d
Application:: ELISA, WB
Molecular Weight:: 57kda
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: CSRMFKHARSLSSHQRTHLNKKSELLCVTCQKMFKRVSDRRTHEIIHMPEKPFKCSTCEKSFSHKTNLKSHEMIHTGEMPYVCSLCSRRFRQSSTYHRHLRNYHRSD
Synonyms:: Gm397;XM_142517;zinc finger and SCAN domain containing protein 4C;zinc finger and SCAN domain-containing protein 4;zinc finger protein 494;ZNF494;Zscan4d
Extra Details:: Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Acts upstream of or within negative regulation of mitotic recombination; regulation of transcription by RNA polymerase II; and telomere maintenance via telomere lengthening. Located in chromosome, telomeric region; cytoplasm; and nucleus. Is expressed in 1-cell stage embryo; 2-cell stage embryo; primary oocyte; and secondary oocyte. Orthologous to human ZSCAN4 (zinc finger and SCAN domain containing 4).