A10190
IARS Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A10190
- Additional Names:
- GRIDHH|IARS|ILERS|ILRS|IRS|PRO0785
- Application:
- ELISA, WB
- Molecular Weight:
- 144kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SAPSLINSSSTLLCQYINLQLLNAKPQECLMGTVGTLLLENPLGQNGLTHQGLLYEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTADF
- Uniprot:
- P41252
- Synonyms:
- GRIDHH;IARS;ILERS;ILRS;IRS;isoleucine tRNA ligase 1, cytoplasmic;isoleucine--tRNA ligase, cytoplasmic;Isoleucyl-tRNA synthetase;PRO0785
- Extra Details:
- Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAS, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Isoleucine-tRNA synthetase belongs to the class-I aminoacyl-tRNA synthetase family and has been identified as a target of autoantibodies in the autoimmune disease polymyositis/dermatomyositis. Alternatively spliced transcript variants have been found.
- Shipping Conditions:
- Blue Ice