HRH4 Rabbit polyclonal antibody

Size

£152.00

SKU:: A10151
Additional Names:: AXOR35|BG26|GPCR105|GPRv53|H4|H4R|HH4R|HRH4
Application:: ELISA, WB
Molecular Weight:: 44kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: NMNIYWSLWKRDHLSRCQSHPGLTAVSSNICGHSFRGRLSSRRSLSASTEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQREHVELLRARRLAKS
Uniprot:: Q9H3N8
Synonyms:: AXOR35;BG26;G-protein coupled receptor 105;GPCR105;GPRv53;H4;H4R;HH4R;histamine H4 receptor;pfi-013;SP9144
Extra Details:: Histamine is a ubiquitous messenger molecule released from mast cells, enterochromaffin-like cells, and neurons. Its various actions are mediated by a family of histamine receptors, which are a subset of the G-protein coupled receptor superfamily. This gene encodes a histamine receptor that is predominantly expressed in haematopoietic cells. The protein is thought to play a role in inflammation and allergy reponses. Multiple transcript variants encoding different isoforms have been found for this gene.