IL17RB Rabbit polyclonal antibody

Size

£152.00

SKU:: A10147
Additional Names:: CRL4|EVI27|IL17BR|IL17RB|IL17RH1
Application:: ELISA, WB
Molecular Weight:: 75kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: REPTVQCGSETGPSPEWMLQHDLIPGDLRDLRVEPVTTSVATGDYSILMNVSWVLRADASIRLLKATKICVTGKSNFQSYSCVRCNYTEAFQTQTRPSGGKWTFSYIGFPVELNTVYFIGAHNIPNANMNEDGPSMSVNFTSPGCLDHIMKYKKKCVKAGSLWDPNITACKKNEETVEVNFTTTPLGNRYMALIQHSTIIGFSQVFEPHQKKQTRASVVIPVTGDSEGATVQLTPYFPTCGSDCIRHKGTVVLCPQTGVPFPLDNNKSKPGGWLP
Uniprot:: Q9NRM6
Synonyms:: CRL4;cytokine receptor CRL4;cytokine receptor-like 4;EVI27;IL-17 receptor B;IL-17 receptor homolog 1;IL-17B receptor;IL-17RB;IL-17Rh1;IL17BR;IL17RH1;interleukin 17 receptor homolog 1;interleukin-17 receptor B;interleukin-17B receptor
Extra Details:: The protein encoded by this gene is a cytokine receptor. This receptor specifically binds to IL17B and IL17E, but does not bind to IL17 and IL17C. This receptor has been shown to mediate the activation of NF-kappaB and the production of IL8 induced by IL17E. The expression of the rat counterpart of this gene was found to be significantly up-regulated during intestinal inflammation, which suggested the immunoregulatory activity of this receptor.