TRPM4 Rabbit polyclonal antibody

Size

£152.00

SKU:: A10146
Additional Names:: EKVP6|hTRPM4|LTrpC4|PFHB1B|TRPM4|TRPM4B
Application:: ELISA, WB
Molecular Weight:: 134kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MVVPEKEQSWIPKIFKKKTCTTFIVDSTDPGGTLCQCGRPRTAHPAVAMEDAFGAAVVTVWDSDAHTTEKPTDAYGELDFTGAGRKHSNFLRLSDRTDPAAVYSLVTRTWGFRAPNLVVSVLGGSGGPVLQTWLQDLLRRGLVRAAQSTGAWIVTGGLHTGIGRHVGVAVRDHQMASTGGTKVVAMGVAPWGVVRNRDTLINPKGSFPARYRWRGDPEDGVQFPLDYNYSAFFLVDDGTH
Uniprot:: Q8TD43
Synonyms:: calcium-activated non-selective cation channel 1;EKVP6;hTRPM4;long transient receptor potential channel 4;LTrpC4;melastatin-4;PFHB1B;transient receptor potential cation channel subfamily M member 4;TRPM4B
Extra Details:: The protein encoded by this gene is a calcium-activated nonselective ion channel that mediates transport of monovalent cations across membranes, thereby depolarizing the membrane. The activity of the encoded protein increases with increasing intracellular calcium concentration, but this channel does not transport calcium.