A10138
TXNL4A Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A10138
- Additional Names:
- BMKS|DIB1|DIM1|SNRNP15|TXNL4|TXNL4A|U5-15kD
- Application:
- ELISA, WB
- Molecular Weight:
- 13kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY
- Uniprot:
- P83876
- Synonyms:
- BMKS;DIB1;DIM1;DIM1 protein homolog;SNRNP15;spliceosomal U5 snRNP-specific 15 kDa protein;thioredoxin-like 4;thioredoxin-like protein 4A;thioredoxin-like U5 snRNP protein U5-15kD;TXNL4;U5-15kD
- Extra Details:
- The protein encoded by this gene is a member of the U5 small ribonucleoprotein particle (snRNP), and is involved in pre-mRNA splicing. This protein contains a thioredoxin-like fold and it is expected to interact with multiple proteins. Protein-protein interactions have been observed with the polyglutamine tract-binding protein 1 (PQBP1). Mutations in both the coding region and promoter region of this gene have been associated with Burn-McKeown syndrome, which is a rare disorder characterized by craniofacial dysmorphisms, cardiac defects, hearing loss, and bilateral choanal atresia. A pseudogene of this gene is found on chromosome 2. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice