A10130
RPS6KA4 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A10130
- Additional Names:
- MSK2|RPS6KA4|RSK-B|S6K-alpha-4
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 85kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- WLQDGSARSSPPLRTPDVLESSGPAVRSGLNATFMAFNRGKREGFFLKSVENAPLAKRRKQKLRSATASRRGSPAPANPGRAPVASKGAPRRANGPLPPS
- Uniprot:
- O75676
- Synonyms:
- 90 kDa ribosomal protein S6 kinase 4;mitogen- and stress-activated protein kinase 2;MSK2;nuclear mitogen- and stress-activated protein kinase 2;ribosomal protein kinase B;ribosomal protein S6 kinase alpha-4;ribosomal protein S6 kinase, 90kDa, polypeptide 4;RSK-B;S6K-alpha-4
- Extra Details:
- This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates various substrates, including CREB1 and ATF1. The encoded protein can also phosphorylate histone H3 to regulate certain inflammatory genes. Several transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice