SLC31A1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A10109
Additional Names:: COPT1|CTR1|NSCT|SLC31A1
Application:: ELISA, WB
Molecular Weight:: 30 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSHGGGDSSMMMMPMTFYFGFKNVELLFSG
Uniprot:: O15431
Synonyms:: copper transport 1 homolog;copper transporter 1;COPT1;CTR1;high affinity copper uptake protein 1;solute carrier family 31 (copper transporter), member 1;solute carrier family 31 (copper transporters), member 1;Solute carrier family 31 member 1
Extra Details:: The protein encoded by this gene is a high-affinity copper transporter found in the cell membrane. The encoded protein functions as a homotrimer to effect the uptake of dietary copper.