GRIN2D Rabbit polyclonal antibody

Size

£152.00

SKU:: A10080
Additional Names:: DEE46|EB11|EIEE46|GluN2D|GRIN2D|NMDAR2D|NR2D
Application:: ELISA, WB
Molecular Weight:: 170kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: GAQALLRDYGFLPELGHDCRAQNRTHRGESLHRYFMNITWDNRDYSFNEDGFLVNPSLVVISLTRDRTWEVVGSWEQQTLRLKYPLWSRYGRFLQPVDDTQHLTVATLEERPFVIVEPADPISGTCIRDSVPCRSQLNRTHSPPPDAPRPE
Uniprot:: O15399
Synonyms:: DEE46;EB11;EIEE46;estrogen receptor binding CpG island;GluN2D;glutamate [NMDA] receptor subunit epsilon-4;glutamate receptor ionotropic, NMDA 2D;glutamate receptor, ionotropic, N-methyl D-aspartate 2D;N-methyl D-aspartate receptor subtype 2D;N-methyl-d-aspartate receptor subunit 2D;NMDAR2D;NR2D
Extra Details:: N-methyl-D-aspartate (NMDA) receptors are a class of ionotropic glutamate receptors. NMDA channel has been shown to be involved in long-term potentiation, an activity-dependent increase in the efficiency of synaptic transmission thought to underlie certain kinds of memory and learning. NMDA receptor channels are heteromers composed of the key receptor subunit NMDAR1 (GRIN1) and 1 or more of the 4 NMDAR2 subunits: NMDAR2A (GRIN2A), NMDAR2B (GRIN2B), NMDAR2C (GRIN2C), and NMDAR2D (GRIN2D).