A10079
CD53 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A10079
- Additional Names:
- CD53|MOX44|TSPAN25
- Application:
- ELISA, WB
- Molecular Weight:
- 35-45kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- AILLFVYEQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHS
- Uniprot:
- P19397
- Synonyms:
- antigen MOX44 identified by monoclonal antibody MRC-OX44;CD53 antigen;CD53 glycoprotein;CD53 tetraspan antigen;cell surface antigen;cell surface glycoprotein CD53;leukocyte surface antigen CD53;MOX44;tetraspanin-25;transmembrane glycoprotein;tspan-25;TSPAN25
- Extra Details:
- The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. It contributes to the transduction of CD2-generated signals in T cells and natural killer cells and has been suggested to play a role in growth regulation. Familial deficiency of this gene has been linked to an immunodeficiency associated with recurrent infectious diseases caused by bacteria, fungi and viruses. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice

