PIAS1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A1007
Additional Names:: DDXBP1|GBP|GU/RH-II|PIAS1|ZMIZ3
Application:: ELISA, WB
Molecular Weight:: 76kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKELYRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHELELPHLTSALHPVHPDIKLQK
Uniprot:: O75925
Synonyms:: AR interacting protein;DDXBP1;DEAD/H (Asp-Glu-Ala-Asp/His) box binding protein 1;DEAD/H box-binding protein 1;E3 SUMO-protein ligase PIAS1;E3 SUMO-protein transferase PIAS1;GBP;gu-binding protein;GU/RH-II;protein inhibitor of activated STAT protein 1;RNA helicase II-binding protein;zinc finger, MIZ-type containing 3;ZMIZ3
Extra Details:: This gene encodes a member of the protein inhibitor of activated STAT (PIAS) family. PIAS proteins function as SUMO E3 ligases and play important roles in many cellular processes by mediating the sumoylation of target proteins. This protein plays a central role as a transcriptional coregulator of numerous cellular pathways includign the STAT1 and nuclear factor kappaB pathways. Alternate splicing results in multiple transcript variants.