A10054
POU2F3 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A10054
- Additional Names:
- Epoc-1|OCT-11|OCT11|OTF-11|PLA-1|PLA1|POU2F3|Skn-1a
- Application:
- ELISA, WB
- Molecular Weight:
- 45-60kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MVNLESMHTDIKMSGDVADSTDARSTLSQVEPGNDRNGLDFNRQIKTEDLSDSLQQTLSHRPCHLSQGPAMMSGNQMSGLNASPCQDMASLHPLQQLVLVPGHLQSVSQFLLSQTQPGQQGLQPNLLPFPQQQSGLLLPQTGPGLASQAFGHPGLPGSSLEPHLEASQHLPVPKHLPSSG
- Uniprot:
- Q9UKI9
- Synonyms:
- Epoc-1;OCT-11;OCT11;octamer-binding protein 11;octamer-binding transcription factor 11;OTF-11;PLA-1;PLA1;POU domain transcription factor OCT11a;POU domain, class 2, transcription factor 3;Skn-1a;transcription factor PLA-1;transcription factor Skn-1
- Extra Details:
- This gene encodes a member of the POU domain family of transcription factors. POU domain transcription factors bind to a specific octamer DNA motif and regulate cell type-specific differentiation pathways. The encoded protein is primarily expressed in the epidermis, and plays a critical role in keratinocyte proliferation and differentiation. The encoded protein is also a candidate tumor suppressor protein, and aberrant promoter methylation of this gene may play a role in cervical cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
- Shipping Conditions:
- Blue Ice

