A10053
PATZ1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A10053
- Additional Names:
- dJ400N23|MAZR|PATZ|PATZ1|RIAZ|ZBTB19|ZNF278|ZSG
- Application:
- ELISA, WB
- Molecular Weight:
- 74kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- PFPSVASSAPPLTGKRGRGRPRKANLLDSMFGSPGGLREAGILPCGLCGKVFTDANRLRQHEAQHGVTSLQLGYIDLPPPRLGENGLPISEDPDGPRKRSR
- Uniprot:
- Q9HBE1
- Synonyms:
- BTB-POZ domain zinc finger transcription factor;BTB/POZ domain zinc finger transcription factor;dJ400N23;MAZ-related factor;MAZR;PATZ;POZ-, AT hook-, and zinc finger-containing protein 1;POZ-AT hook-zinc finger protein;protein kinase A RI subunit alpha-associated protein;RIAZ;ZBTB19;zinc finger and BTB domain-containing protein 19;zinc finger protein 278;zinc finger sarcoma gene protein;ZNF278;ZSG
- Extra Details:
- The protein encoded by this gene contains an A-T hook DNA binding motif which usually binds to other DNA binding structures to play an important role in chromatin modeling and transcription regulation. Its Poz domain is thought to function as a site for protein-protein interaction and is required for transcriptional repression, and the zinc-fingers comprise the DNA binding domain. Since the encoded protein has typical features of a transcription factor, it is postulated to be a repressor of gene expression. In small round cell sarcoma, this gene is fused to EWS by a small inversion of 22q, then the hybrid is thought to be translocated (t(1;22)(p36.1;q12). The rearrangement of chromosome 22 involves intron 8 of EWS and exon 1 of this gene creating a chimeric sequence containing the transactivation domain of EWS fused to zinc finger domain of this protein. This is a distinct example of an intra-chromosomal rearrangement of chromosome 22. Four alternatively spliced transcript variants are described for this gene.
- Shipping Conditions:
- Blue Ice

