RTN4RL1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A10021
Additional Names:: NgR3|NGRH2|RTN4RL1
Application:: ELISA, WB
Molecular Weight:: 49kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LRRLTTLFLFNNSLSELQGECLAPLGALEFLRLNGNPWDCGCRARSLWEWLQRFRGSSSAVPCVSPGLRHGQDLKLLRAEDFRNCTGPASPHQIKSHTLTTTDRAARKEHHSPHGPTRSKGHPHGPRPGHRKPGKNCTNPRNRNQISKAGAGKQAPELPDYAPDYQHKFSFDIMPTARPKRKGKCARRTPIRAPSGVQQAS
Uniprot:: Q86UN2
Synonyms:: NgR3;NGRH2;nogo receptor-like 2;Nogo-66 receptor homolog 2;Nogo-66 receptor-related protein 3;reticulon-4 receptor-like 1
Extra Details:: Enables signaling receptor activity. Predicted to be involved in negative regulation of axon regeneration. Located in cell surface. Is anchored component of plasma membrane.