KLF6 Rabbit polyclonal antibody

Size

£152.00

SKU:: A10011
Additional Names:: BCD1|CBA1|COPEB|CPBP|GBF|KLF6|PAC1|ST12|ZF9
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 45 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ERYLQSEPCYVSASEIKFDSQEDLWTKIILAREKKEESELKISSSPPEDTLISPSFCYNLETNSLNSDVSSESSDSSEELSPTAKFTSDPIGEVLVSSGKLSSSVTSTPPSSPELSREPSQLWGCVPGELPSPGKVRSGTSGKPGDKGNGDASPDGRRRVH
Uniprot:: Q99612
Synonyms:: B-cell-derived protein 1;BCD1;CBA1;COPEB;core promoter element binding protein;Core promoter element-binding protein;CPBP;GBF;GC-rich binding factor;GC-rich sites-binding factor GBF;Krueppel-like factor 6;Kruppel-like zinc finger protein Zf9;PAC1;proto-oncogene BCD1;protooncogene B-cell derived 1;ST12;suppression of tumorigenicity 12 (prostate);suppressor of tumorigenicity 12 protein;transcription factor Zf9;ZF9
Extra Details:: This gene encodes a member of the Kruppel-like family of transcription factors. The zinc finger protein is a transcriptional activator, and functions as a tumor suppressor. Multiple transcript variants encoding different isoforms have been found for this gene, some of which are implicated in carcinogenesis.