A0989
Grp94 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A0989
- Additional Names:
- ECGP|GP96|GRP94|HEL-S-125m|HEL35|TRA1
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 110kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- EGSRTDDEVVQREEEAIQLDGLNASQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTETVEEPMEEEEAAKEEKEESDDEA
- Uniprot:
- P14625
- Synonyms:
- 94 kDa glucose-regulated protein;ECGP;endoplasmin;endothelial cell (HBMEC) glycoprotein;epididymis luminal protein 35;epididymis secretory sperm binding protein Li 125m;GP96;gp96 homolog;GRP94;heat shock protein 90 kDa beta member 1;heat shock protein 90kDa beta (Grp94), member 1;heat shock protein 90kDa beta family member 1;HEL-S-125m;HEL35;stress-inducible tumor rejection antigen gp96;TRA1;tumor rejection antigen (gp96) 1;tumor rejection antigen 1
- Extra Details:
- This gene encodes a member of a family of adenosine triphosphate(ATP)-metabolizing molecular chaperones with roles in stabilizing and folding other proteins. The encoded protein is localized to melanosomes and the endoplasmic reticulum. Expression of this protein is associated with a variety of pathogenic states, including tumor formation. There is a microRNA gene located within the 5' exon of this gene. There are pseudogenes for this gene on chromosomes 1 and 15.
- Shipping Conditions:
- Blue Ice








