NEK8 Rabbit polyclonal antibody

Size

£152.00

SKU:: A0984
Additional Names:: JCK|NEK12A|NEK8|NPHP9|RHPD2
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 70kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: GSVRMRRAEKSVAPSNTGSRTTSVRCRGIPRGPVRPAIPPPLSSVYAWGGGLGTPLRLPMLNTEVVQVAAGRTQKAGVTRSGRLILWEAPPLGAGGGSLLPGAVEQPQPQFISRFLEGQSG
Uniprot:: Q86SG6
Synonyms:: JCK;NEK12A;nephrocystin 9;never in mitosis A-related kinase 8;NIMA (never in mitosis gene a)- related kinase 8;NIMA-family kinase NEK8;NIMA-related kinase 12a;nima-related protein kinase 12a;nimA-related protein kinase 8;NPHP9;RHPD2;serine/threonine-protein kinase Nek8;serine/thrionine-protein kinase NEK8
Extra Details:: This gene encodes a member of the serine/threionine protein kinase family related to NIMA (never in mitosis, gene A) of Aspergillus nidulans. The encoded protein may play a role in cell cycle progression from G2 to M phase. Mutations in the related mouse gene are associated with a disease phenotype that closely parallels the juvenile autosomal recessive form of polycystic kidney disease in humans.