A0977
SNX9 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A0977
- Additional Names:
- SDP1|SH3PX1|SH3PXD3A|SNX9|WISP
- Application:
- ELISA, WB
- Molecular Weight:
- 90kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MATKARVMYDFAAEPGNNELTVNEGEIITITNPDVGGGWLEGRNIKGERGLVPTDYVEILPSDGKDQFSCGNSVADQAFLDSLSASTAQASSSAASNNHQVGSGNDPWSAWSASKSGNWESSEGWGAQPEGAGAQRNTNTPNNWDTAFGHPQAYQGPATGDDDDWDEDWDGPKSSSYFKDSESADAGGAQRGNSRASSSSMKIPLNKFPG
- Uniprot:
- Q9Y5X1
- Synonyms:
- SDP1;SH3 and PX domain-containing protein 1;SH3 and PX domain-containing protein 3A;SH3PX1;SH3PXD3A;sorting nexin-9;Wiskott-Aldrich syndrome protein (WASP) interactor protein;WISP
- Extra Details:
- This gene encodes a member of the sorting nexin family. Members of this family contain a phosphoinositide binding domain, and are involved in intracellular trafficking. The encoded protein does not contain a coiled coil region, like some family members, but does contain a SRC homology domain near its N-terminus. The encoded protein is reported to have a variety of interaction partners, including of adaptor protein 2 , dynamin, tyrosine kinase non-receptor 2, Wiskott-Aldrich syndrome-like, and ARP3 actin-related protein 3. The encoded protein is implicated in several stages of intracellular trafficking, including endocytosis, macropinocytosis, and F-actin nucleation.
- Shipping Conditions:
- Blue Ice

