A0974
eEF1A1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A0974
- Additional Names:
- CCS-3|CCS3|EE1A1|EEF-1|EEF1A|eEF1A-1|eEF1A1|EF-Tu|EF1A|EF1A1|EF1alpha1|GRAF-1EF|LENG7|PTI1
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 50kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- FEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK
- Uniprot:
- P68104
- Synonyms:
- CCS-3;CCS3;cervical cancer suppressor 3;CTCL tumor antigen;EE1A1;EEF-1;EEF1A;eEF1A-1;EF-1-alpha-1;EF-Tu;EF1A;EF1a-like protein;elongation factor 1 alpha subunit;elongation factor 1-alpha 1;elongation factor Tu;epididymis secretory sperm binding protein;eukaryotic elongation factor 1 A-1;eukaryotic translation elongation factor 1 alpha 1-like 14;glucocorticoid receptor AF-1 specific elongation factor;GRAF-1EF;LENG7;leukocyte receptor cluster (LRC) member 7;leukocyte receptor cluster member 7;prostate tumor-inducing protein 1;PTI1;translation elongation factor 1 alpha 1-like 14
- Extra Details:
- This gene encodes an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas, and the other isoform (alpha 2) is expressed in brain, heart and skeletal muscle. This isoform is identified as an autoantigen in 66% of patients with Felty syndrome. This gene has been found to have multiple copies on many chromosomes, some of which, if not all, represent different pseudogenes.
- Shipping Conditions:
- Blue Ice



