A0968
Human Parkin Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A0968
- Additional Names:
- AR-JP|LPRS2|PARK2|Parkin|PDJ
- Application:
- ELISA, WB, IHC-P, IF
- Molecular Weight:
- 52kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- NATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHD
- Uniprot:
- O60260
- Synonyms:
- AR-JP;E3 ubiquitin-protein ligase parkin;LPRS2;PARK2;Parkin RBR E3 ubiquitin-protein ligase;Parkinson disease (autosomal recessive, juvenile) 2, parkin;parkinson juvenile disease protein 2;parkinson protein 2 E3 ubiquitin protein ligase;parkinson protein 2, E3 ubiquitin protein ligase (parkin);PDJ
- Extra Details:
- The precise function of this gene is unknown; however, the encoded protein is a component of a multiprotein E3 ubiquitin ligase complex that mediates the targeting of substrate proteins for proteasomal degradation. Mutations in this gene are known to cause Parkinson disease and autosomal recessive juvenile Parkinson disease. Alternative splicing of this gene produces multiple transcript variants encoding distinct isoforms. Additional splice variants of this gene have been described but currently lack transcript support.
- Shipping Conditions:
- Blue Ice





_IHC_01.jpg)
_IF_01.jpg)
_IF_02.jpg)