Human Parkin Rabbit polyclonal antibody

Size

£152.00

SKU:: A0968
Additional Names:: AR-JP|LPRS2|PARK2|Parkin|PDJ
Application:: ELISA, WB, IHC-P, IF
Molecular Weight:: 52kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: NATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHD
Uniprot:: O60260
Synonyms:: AR-JP;E3 ubiquitin-protein ligase parkin;LPRS2;PARK2;Parkin RBR E3 ubiquitin-protein ligase;Parkinson disease (autosomal recessive, juvenile) 2, parkin;parkinson juvenile disease protein 2;parkinson protein 2 E3 ubiquitin protein ligase;parkinson protein 2, E3 ubiquitin protein ligase (parkin);PDJ
Extra Details:: The precise function of this gene is unknown; however, the encoded protein is a component of a multiprotein E3 ubiquitin ligase complex that mediates the targeting of substrate proteins for proteasomal degradation. Mutations in this gene are known to cause Parkinson disease and autosomal recessive juvenile Parkinson disease. Alternative splicing of this gene produces multiple transcript variants encoding distinct isoforms. Additional splice variants of this gene have been described but currently lack transcript support.

Shipping Conditions:: Blue Ice