Olig1 Rabbit monoclonal antibody

Size

POA

SKU:: A0953
Additional Names:: BHLHB6|BHLHE21|Olig1
Application:: ELISA, WB
Molecular Weight:: 27kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: RRALGEGAGPAAPRLLLAGLPLLAAAPGSVLLAPGAVGPPDALRPAKYLSLALDEPPCGQFALPGGGAGGPGLCTCAVCKFPHLVPASLGLAAVQAQFSK
Uniprot:: Q8TAK6
Synonyms:: basic domain, helix-loop-helix protein, class B, 6;BHLHB6;BHLHE21;class B basic helix-loop-helix protein 6;class E basic helix-loop-helix protein 21;oligo1;oligodendrocyte lineage transcription factor 1;oligodendrocyte transcription factor 1;oligodendrocyte-specific bHLH transcription factor 1
Extra Details:: Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in neuron differentiation and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within neuron fate commitment. Predicted to be part of chromatin. Predicted to be active in nucleus.