FABP5 Rabbit polyclonal antibody

Size

£152.00

SKU:: A0947
Additional Names:: E-FABP|EFABP|FABP5|KFABP|PA-FABP|PAFABP
Application:: ELISA, WB
Molecular Weight:: 14kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEW
Uniprot:: Q01469
Synonyms:: E-FABP;EFABP;epidermal-type fatty acid-binding protein;fatty acid binding protein 5 (psoriasis-associated);fatty acid-binding protein 5;Fatty acid-binding protein, epidermal;KFABP;PA-FABP;PAFABP;psoriasis-associated fatty acid-binding protein homolog
Extra Details:: This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs may play roles in fatty acid uptake, transport, and metabolism. Polymorphisms in this gene are associated with type 2 diabetes. The human genome contains many pseudogenes similar to this locus.