LRRK2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A0859
Additional Names:: AURA17|DARDARIN|LRRK2|PARK8|RIPK7|ROCO2
Application:: ELISA, WB, IHC-P
Molecular Weight:: 290kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: EKESSPKLVELLLNSGSREQDVRKALTISIGKGDSQIISLLLRRLALDVANNSICLGGFCIGKVEPSWLGPLFPDKTSNLRKQTNIASTLARMVIRYQMKSAVEEGTASGSDGNFSEDVLSKFDEWTFIPDSSMDSVFAQSDDLDSEGSEGSFLVKKKSNS
Uniprot:: Q5S007
Synonyms:: augmented in rheumatoid arthritis 17;AURA17;DARDARIN;leucine-rich repeat serine/threonine-protein kinase 2;PARK8;RIPK7;ROCO2
Extra Details:: This gene is a member of the leucine-rich repeat kinase family and encodes a protein with an ankryin repeat region, a leucine-rich repeat (LRR) domain, a kinase domain, a DFG-like motif, a RAS domain, a GTPase domain, a MLK-like domain, and a WD40 domain. The protein is present largely in the cytoplasm but also associates with the mitochondrial outer membrane. Mutations in this gene have been associated with Parkinson disease-8.