A0821
ADAM17 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A0821
- Additional Names:
- ADAM17|ADAM18|CD156B|CSVP|NISBD|NISBD1|TACE
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 120kDa/100kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- KQYESLSLFHPSNVEMLSSMDSASVRIIKPFPAPQTPGRLQPAPVIPSAPAAPKLDHQRMDTIQEDPSTDSHMDEDGFEKDPFPNSSTAAKSFEDLTDHPVTRSEKAASFKLQRQNRVDSKETEC
- Uniprot:
- P78536
- Synonyms:
- a disintegrin and metalloproteinase 17;ADAM metallopeptidase domain 18;ADAM18;cartilage snake venom-like protease;CD156B;CSVP;disintegrin and metalloproteinase domain-containing protein 17;NISBD;NISBD1;snake venom-like protease;TACE;TNF-alpha convertase;TNF-alpha convertase enzyme;TNF-alpha converting enzyme;TNF-alpha-converting enzyme;tumor necrosis factor, alpha, converting enzyme
- Extra Details:
- This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biologic processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The encoded preproprotein is proteolytically processed to generate the mature protease. The encoded protease functions in the ectodomain shedding of tumor necrosis factor-alpha, in which soluble tumor necrosis factor-alpha is released from the membrane-bound precursor. This protease also functions in the processing of numerous other substrates, including cell adhesion proteins, cytokine and growth factor receptors and epidermal growth factor (EGF) receptor ligands, and plays a prominent role in the activation of the Notch signaling pathway. Elevated expression of this gene has been observed in specific cell types derived from psoriasis, rheumatoid arthritis, multiple sclerosis and Crohn's disease patients, suggesting that the encoded protein may play a role in autoimmune disease. Additionally, this protease may play a role in viral infection through its cleavage of ACE2, the cellular receptor for SARS-CoV and SARS-CoV-2.
- Shipping Conditions:
- Blue Ice








