PAK1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A0809
Additional Names:: alpha-PAK|IDDMSSD|p65-PAK|PAK1|PAKalpha
Application:: ELISA, WB
Molecular Weight:: 68kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: FYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSD
Uniprot:: Q13153
Synonyms:: alpha-PAK;IDDMSSD;p21 protein (Cdc42/Rac)-activated kinase 1;p21-activated kinase 1;p21/Cdc42/Rac1-activated kinase 1 (STE20 homolog, yeast);p21/Cdc42/Rac1-activated kinase 1 (yeast Ste20-related);p65-PAK;PAKalpha;serine/threonine-protein kinase PAK 1;STE20 homolog, yeast
Extra Details:: This gene encodes a family member of serine/threonine p21-activating kinases, known as PAK proteins. These proteins are critical effectors that link RhoGTPases to cytoskeleton reorganization and nuclear signaling, and they serve as targets for the small GTP binding proteins Cdc42 and Rac. This specific family member regulates cell motility and morphology. Mutations in this gene have been associated with macrocephaly, seizures, and speech delay. Overexpression of this gene is also reported in many cancer types, and particularly in breast cancer. Alternative splicing results in multiple transcript variants.

Shipping Conditions:: Blue Ice