Erlin-2 Rabbit monoclonal antibody

Size

POA

SKU:: A0781
Additional Names:: C8orf2|Erlin-2|NET32|SPFH2|SPG18
Application:: ELISA, WB, IHC-P
Molecular Weight:: 43kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: HLMLPFITSYKSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKIHHELNQFCSVHTLQEVYIELFDQIDENLKL
Uniprot:: O94905
Synonyms:: C8orf2;endoplasmic reticulum lipid raft-associated protein 2;epididymis secretory sperm binding protein;erlin-2;NET32;spastic paraplegia 18 (autosomal dominant);SPFH domain family, member 2;SPFH2;SPG18;stomatin-prohibitin-flotillin-HflC/K domain-containing protein 2
Extra Details:: This gene encodes a member of the SPFH domain-containing family of lipid raft-associated proteins. The encoded protein is localized to lipid rafts of the endoplasmic reticulum and plays a critical role in inositol 1,4,5-trisphosphate (IP3) signaling by mediating ER-associated degradation of activated IP3 receptors. Mutations in this gene are a cause of spastic paraplegia-18 (SPG18). Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.