A0730
Tyro3 Rabbit monoclonal antibody
Size
POA
- SKU:
- A0730
- Additional Names:
- BYK|Dtk|Etk-2|Rek|RSE|Sky|Tif|Tyro3
- Application:
- ELISA, WB
- Molecular Weight:
- 130kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- GQLSVLSASQDPLYINIERAEEPTAGGSLELPGRDQPYSGAGDGSGMGAVGGTPSDCRYILTPGGLAEQPGQAEHQPESPLNETQRLLLLQQGLLPHSSC
- Uniprot:
- Q06418
- Synonyms:
- BYK;Dtk;Etk-2;Rek;RSE;Sky;Tif;tyrosine-protein kinase byk;tyrosine-protein kinase DTK;tyrosine-protein kinase receptor TYRO3;tyrosine-protein kinase RSE;tyrosine-protein kinase SKY;tyrosine-protein kinase TIF
- Extra Details:
- The gene is part of a 3-member transmembrane receptor kinase receptor family with a processed pseudogene distal on chromosome 15. The encoded protein is activated by the products of the growth arrest-specific gene 6 and protein S genes and is involved in controlling cell survival and proliferation, spermatogenesis, immunoregulation and phagocytosis. The encoded protein has also been identified as a cell entry factor for Ebola and Marburg viruses.
- Shipping Conditions:
- Blue Ice